PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G030400.1
Common NamePHAVU_006G030400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SRS
Protein Properties Length: 363aa    MW: 38849.5 Da    PI: 7.2189
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G030400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702210.93.2e-651393002154
              DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkls 92 
                         +sgt++CqdCGnqakkdC+h+RCRtCCksrgfdC thvkstWvpaa+rrerq ++ +a+    +s +++ +k++r    ++++++s+t++s
  Phvul.006G030400.1 139 GSGTSTCQDCGNQAKKDCSHRRCRTCCKSRGFDCVTHVKSTWVPAARRRERQLMTVTAAVG--SSGSTSVTKKPRLV-PSQTTTTSHTSTS 226
                         57999**********************************************8777666444..45578888899976.4444555555444 PP

              DUF702  93 ..saeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                           +++++++++t s          lP +v+++a f+cvrv++vddg++e+aYq++v+igGhvfkG+LydqG+e+
  Phvul.006G030400.1 227 nnTTTPPRSFDTGSshqdvsfkesLPCQVRAPAEFKCVRVTAVDDGDDEYAYQAVVKIGGHVFKGFLYDQGVED 300
                         004566778887778999******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.1E-60142299IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.0E-27144186IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.7E-28251298IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MWPGVSRSFN HNLSPHHDIF VVAPASSFHH HHHNDAVLSD PSNNSSNGTA LGVNVFPLLT  60
ATPCLTPESE GIMGNINNHR NRIQLWQPQE SPQHQHADGV LASNHRGRIQ LWQEHDESPP  120
QQQQHPNAHV HEREGSGSGS GTSTCQDCGN QAKKDCSHRR CRTCCKSRGF DCVTHVKSTW  180
VPAARRRERQ LMTVTAAVGS SGSTSVTKKP RLVPSQTTTT SHTSTSNNTT TPPRSFDTGS  240
SHQDVSFKES LPCQVRAPAE FKCVRVTAVD DGDDEYAYQA VVKIGGHVFK GFLYDQGVED  300
KSEYPNLSEL HLGGGGNVAS GSDGGGRNGV SSSSPMVDPS DVYAASGGVL LGGSSNYGNA  360
IN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146319.10.0hypothetical protein PHAVU_006G030400g
SwissprotQ94CK99e-80LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLV7BMQ00.0V7BMQ0_PHAVU; Uncharacterized protein
STRINGGLYMA20G05015.11e-146(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.25e-68Lateral root primordium (LRP) protein-related